missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00 EUR
Specifications
| Antigen | ADAD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ADAD2 Polyclonal specifically detects ADAD2 in Human samples. It is validated for Western Blot.Specifications
| ADAD2 | |
| Polyclonal | |
| Rabbit | |
| Q8NCV1 | |
| 161931 | |
| Synthetic peptides corresponding to ADAD2(adenosine deaminase domain containing 2) The peptide sequence was selected from the C terminal of ADAD2. Peptide sequence TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| adenosine deaminase domain containing 2, adenosine deaminase domain-containing protein 2, TENRLFLJ00337, Testis nuclear RNA-binding protein-like | |
| ADAD2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title