All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (442)
- (490)
- (13)
- (1)
- (27)
- (2)
- (3)
- (14)
- (15)
- (15)
- (15)
- (15)
- (15)
- (14)
- (14)
- (4)
- (21)
- (1)
- (2)
- (2)
- (2)
- (3)
- (3)
- (3)
- (3)
- (3)
- (5)
- (3)
- (3)
- (2)
- (3)
- (3)
- (4)
- (15)
- (15)
- (14)
- (14)
- (15)
- (16)
- (15)
- (14)
- (14)
- (48)
- (4)
- (1)
- (4)
- (17)
- (4)
- (11)
- (13)
- (3)
- (1)
- (62)
- (2)
- (2)
- (4)
- (2)
- (17)
- (2)
- (2)
- (2)
- (365)
- (8)
- (7)
- (8)
- (6)
- (6)
- (362)
- (541)
- (32)
- (2)
- (3)
- (2)
- (3)
- (2)
- (396)
- (15)
- (5)
- (3)
- (1)
- (1)
- (125)
- (84)
- (92)
- (10)
- (1)
- (18)
- (7)
- (4)
- (9)
- (2)
- (15)
- (10)
- (5)
- (1)
- (17)
- (1)
- (3)
- (55)
- (51)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (14)
- (9)
- (2)
- (4)
- (1)
- (3)
- (3)
- (4)
- (3)
- (4)
- (6)
- (875)
- (14)
- (348)
- (2)
- (7)
- (12)
- (5)
- (6)
- (222)
- (5)
- (8)
- (4)
Filtered Search Results
Invitrogen™ GMPS Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ GMPS Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ GMPS Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ GMPS Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ GMPS Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
| Host Species | Rabbit |
|---|---|
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | P49915 |
| Antigen | GMPS |
| Gene Symbols | GMPS |
| Regulatory Status | RUO |
| Molecular Weight of Antigen | 77 kDa |
| Gene Alias | EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein |
| Gene ID (Entrez) | 8833 |
| Immunogen | Synthetic peptides corresponding to GMPS(guanine monphosphate synthetase) The peptide sequence was selected from the middle region of GMPS. Peptide sequence VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunoprecipitation,Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | metabolism |
| Antigen | GMPS |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells |
| Gene Alias | EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein |
| Gene ID (Entrez) | 8833 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 394-693 of human GMPS (NP_003866.1).,, Sequence:, DTELIRKLREEGKVIEPLKDFHKDEVRILGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPHTLLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDWESLIFLARLIPRMCHNVNRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILRESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGIPATPGNEIPVEVVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunocytochemistry,Immunofluorescence |
| Isotype | IgG |
| Research Discipline | metabolism |
| Antigen | GMPS |
| Gene Symbols | GMPS |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Gene Alias | EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein |
| Gene ID (Entrez) | 8833 |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLT |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot |
| Form | Liquid |
| Isotype | IgG |
| Gene Accession No. | P49915, Q3THK7, Q4V7C6 |
| Concentration | 0.34 mg/mL |
| Antigen | GMPS |
| Gene Symbols | Gmps |
| Regulatory Status | RUO |
| Purification Method | Antigen Affinity Chromatography |
| Gene Alias | Glutamine amidotransferase, GMP synthetase, GMPS |
| Gene | GMPS |
| Product Type | Antibody |
| Gene ID (Entrez) | 229363, 295088, 8833 |
| Formulation | PBS with 50% glycerol and 0.02% sodium azide; pH 7.3 |
| Immunogen | GMPS Fusion Protein Ag9350 |
| Classification | Polyclonal |
| Primary or Secondary | Primary |