missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF778 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00 EUR
Specifications
| Antigen | ZNF778 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
ZNF778 Polyclonal specifically detects ZNF778 in Human samples. It is validated for Western Blot.Specifications
| ZNF778 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_872337 | |
| 197320 | |
| Synthetic peptide directed towards the middle region of human FLJ31875. Peptide sequence AFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFYLLNEHGKTHTREKPFA. | |
| Primary | |
| 49 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FLJ31875, MGC150573, zinc finger protein 778 | |
| ZNF778 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title