missing translation for 'onlineSavingsMsg'
Learn More

USP39 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-17961-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331246

  • 575.58 EUR / 100µL
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

USP39 Polyclonal antibody specifically detects USP39 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

USP39
Polyclonal
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
CGI-21, HSPC332, Inactive ubiquitin-specific peptidase 39,65K, SAD1 homolog, SAD1MGC75069, small nuclear ribonucleoprotein 65kDa (U4/U6.U5), SnRNP assembly defective 1 homolog, SNRNP65, U4/U6.U5 tri-snRNP-associated 65 kDa protein, U4/U6.U5 tri-snRNP-associated protein 2, ubiquitin specific peptidase 39, ubiquitin specific protease 39
This antibody was developed against Recombinant Protein corresponding to amino acids: TIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETN
100 μg
Cell Biology
10713
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
IgG
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers