missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 EUR - 574.00 EUR
Specifications
| Antigen | TR beta 1/NR1A2/Thyroid Hormone Receptor beta |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18043156
|
Novus Biologicals
NBP2-57253 |
100 μL |
574.00 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18646216
|
Novus Biologicals
NBP2-57253-25ul |
25 μL |
369.00 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TR beta 1/NR1A2/Thyroid Hormone Receptor beta Polyclonal specifically detects TR beta 1/NR1A2/Thyroid Hormone Receptor beta in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TR beta 1/NR1A2/Thyroid Hormone Receptor beta | |
| Polyclonal | |
| Rabbit | |
| Cancer, Neuroscience | |
| avian erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, c-erbA-2, c-erbA-beta, ERBA2MGC126109, ERBA-BETA, GRTH, MGC126110, NR1A2thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog 2), Nuclear receptor subfamily 1 group A member 2, oncogene ERBA2, PRTH, THR1pituitary resistance to thyroid hormone, THRB1, THRB2, thyroid hormone receptor beta, thyroid hormone receptor beta 1, thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a)oncogene homolog 2, avian) | |
| THRB | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7068 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title