missing translation for 'onlineSavingsMsg'
Learn More

TMEM105 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09895-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331225

  • 449.23 EUR / 100µL
Estimated Shipment: 12-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

TMEM105 Polyclonal specifically detects TMEM105 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TMEM105
Polyclonal
Western Blot 1.0 ug/ml
Rabbit
Affinity purified
RUO
284186
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
PBS buffer, 2% sucrose
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMEM105 (NP_848615). Peptide sequence IGQLIYLLTWSLFTAWLRPPTLLQGPRTSPQGSPPRSPWGDCAEPSCLCE
100 μg
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers