missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPAG11B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91448
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
SPAG11B Polyclonal specifically detects SPAG11B in Human samples. It is validated for Western Blot.
Especificaciones
| SPAG11B | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EP2, sperm associated antigen 11B | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10407 | |
| Human | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_478108 | |
| SPAG11B | |
| Synthetic peptide directed towards the N terminal of human SPAG11B. Peptide sequence MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG. | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido