Learn More
Invitrogen™ SOD2 (MnSOD) Polyclonal Antibody
Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA580049
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Human HepG2 whole cell, rat liver tissue, rat lung tissue, mouse liver tissue, mouse lung tissue. IHC: human mammary cancer tissue. ICC/IF: A549 Cell, SMMC-7721 Cell.
Superoxide dismutase (SOD) is an antioxidant enzyme involved in the defense system against reactive oxygen species (ROS). SOD catalyzes the dismutation reaction of superoxide radical anion (O2) to hydrogen peroxide, which is then catalyzed to innocuous O2 and H2O by glutathione peroxidase and catalase. Several classes of SOD have been identified. These include intracellular copper, zinc SOD (Cu, Zn-SOD/SOD-1), mitochondrial manganese SOD (Mn-SOD/SOD-2) and extracellular Cu, Zn-SOD (EC-SOD/SOD-3). SOD1 is found in all eukaryotic species as a homodimeric 32 kDa enzyme containing one each of Cu and Zn ion per subunit. The manganese containing 80 kDa tetrameric enzyme SOD2, is located in the mitochondrial matrix in close proximity to a primary endogenous source of superoxide, the mitochondrial respiratory chain. SOD3 is a heparin-binding multimer of disulfide-linked dimers, primarily expressed in human lungs, vessel walls and airways. SOD4 is a copper chaperone for superoxide dismutase (CCS), which specifically delivers Cu to copper/zinc superoxide dismutase. CCS may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor.
Specifications
| SOD2 (MnSOD) | |
| Polyclonal | |
| Unconjugated | |
| SOD2 | |
| I79_015272; indophenoloxidase B; IPO B; IPOB; IPO-B; manganese SOD; manganese superoxide dismutase; manganese-containing superoxide dismutase; mangano-superoxide dismutase; manganous superoxide dismutase; mitochondrial superoxide dismutase 2; Mn superoxide dismutase; MNSOD; Mn-SOD; MVCD6; similar to manganous superoxide dismutase; Sod2; Sod-2; sod2.L; sodMt; Superoxide dimutase 2, mitochondrial; superoxide dismutase; superoxide dismutase (Mn type); superoxide dismutase [Mn], mitochondrial; superoxide dismutase 2; superoxide dismutase 2 L homeolog; superoxide dismutase 2, mitochondrial; superoxide dismutase 2, mitochondrial L homeolog | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 20656, 24787, 6648 | |
| -20°C | |
| Lyophilized |
| Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| P04179, P07895, P09671 | |
| SOD2 | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.