missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ SOD2 (MnSOD) Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA580049

Product Code. 15935615

  • 453.00 EUR / 100µg

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Human HepG2 whole cell, rat liver tissue, rat lung tissue, mouse liver tissue, mouse lung tissue. IHC: human mammary cancer tissue. ICC/IF: A549 Cell, SMMC-7721 Cell.

Superoxide dismutase (SOD) is an antioxidant enzyme involved in the defense system against reactive oxygen species (ROS). SOD catalyzes the dismutation reaction of superoxide radical anion (O2) to hydrogen peroxide, which is then catalyzed to innocuous O2 and H2O by glutathione peroxidase and catalase. Several classes of SOD have been identified. These include intracellular copper, zinc SOD (Cu, Zn-SOD/SOD-1), mitochondrial manganese SOD (Mn-SOD/SOD-2) and extracellular Cu, Zn-SOD (EC-SOD/SOD-3). SOD1 is found in all eukaryotic species as a homodimeric 32 kDa enzyme containing one each of Cu and Zn ion per subunit. The manganese containing 80 kDa tetrameric enzyme SOD2, is located in the mitochondrial matrix in close proximity to a primary endogenous source of superoxide, the mitochondrial respiratory chain. SOD3 is a heparin-binding multimer of disulfide-linked dimers, primarily expressed in human lungs, vessel walls and airways. SOD4 is a copper chaperone for superoxide dismutase (CCS), which specifically delivers Cu to copper/zinc superoxide dismutase. CCS may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

SOD2 (MnSOD)
Polyclonal
Unconjugated
SOD2
I79_015272; indophenoloxidase B; IPO B; IPOB; IPO-B; manganese SOD; manganese superoxide dismutase; manganese-containing superoxide dismutase; mangano-superoxide dismutase; manganous superoxide dismutase; mitochondrial superoxide dismutase 2; Mn superoxide dismutase; MNSOD; Mn-SOD; MVCD6; similar to manganous superoxide dismutase; Sod2; Sod-2; sod2.L; sodMt; Superoxide dimutase 2, mitochondrial; superoxide dismutase; superoxide dismutase (Mn type); superoxide dismutase [Mn], mitochondrial; superoxide dismutase 2; superoxide dismutase 2 L homeolog; superoxide dismutase 2, mitochondrial; superoxide dismutase 2, mitochondrial L homeolog
Rabbit
Antigen affinity chromatography
RUO
20656, 24787, 6648
-20°C
Lyophilized
Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
500 μg/mL
PBS with 5mg BSA and 0.05mg sodium azide
P04179, P07895, P09671
SOD2
A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.