missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC6A2/NET/Noradrenaline transporter Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
213.00 EUR - 507.00 EUR
Specifications
| Antigen | SLC6A2/NET/Noradrenaline transporter |
|---|---|
| Dilution | Western Blot 1:2000 - 1:10000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30227563
|
Novus Biologicals
NBP3-33387-20ul |
20 μL |
213.00 EUR
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227263
|
Novus Biologicals
NBP3-33387-100ul |
100 μL |
507.00 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC6A2/NET/Noradrenaline transporter Monoclonal antibody specifically detects SLC6A2/NET/Noradrenaline transporter in Human samples. It is validated for ELISA,Western BlotSpecifications
| SLC6A2/NET/Noradrenaline transporter | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cardiovascular Biology, Neuroscience | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 6530 | |
| IgG | |
| Affinity purified |
| Western Blot 1:2000 - 1:10000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| NAT1neurotransmitter transporter, NET, NET1sodium-dependent noradrenaline transporter, Norepinephrine transporter, SLC6A5, solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2, Solute carrier family 6 member 2, solute carrier family 6 member 5 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SLC6A2/NET/Noradrenaline transporter.1).,, Sequence:, MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLAPRDGDAQPRETWGKKIDFLLSVV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title