missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC20A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
214.00 EUR - 584.00 EUR
Specifications
| Antigen | SLC20A1 |
|---|---|
| Dilution | Western Blot 1:200 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30226479
|
Novus Biologicals
NBP3-38075-100ul |
100 μL |
584.00 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229318
|
Novus Biologicals
NBP3-38075-20ul |
20 μL |
214.00 EUR
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC20A1 Polyclonal antibody specifically detects SLC20A1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| SLC20A1 | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| FLJ41426, Gibbon ape leukemia virus receptor 1, Glvr-1, GLVR1DKFZp686J2397, Leukemia virus receptor 1 homolog, Phosphate transporter 1, PiT-1PIT1, sodium-dependent phosphate transporter 1, solute carrier family 20 (phosphate transporter), member 1, Solute carrier family 20 member 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 257-356 of human SLC20A1 (NP_005406.3).,, Sequence:, KIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:200 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 6574 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title