missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ryanodine Receptor 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 EUR - 593.00 EUR
Specifications
| Antigen | Ryanodine Receptor 1 |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18477381
|
Novus Biologicals
NBP2-33785-25ul |
25 μL |
369.00 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18198373
|
Novus Biologicals
NBP2-33785 |
0.1 mL |
593.00 EUR
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Ryanodine Receptor 1 Polyclonal specifically detects Ryanodine Receptor 1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Ryanodine Receptor 1 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P21817 | |
| 6261 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CCO, central core disease of muscle, MHS, MHS1, PPP1R137, protein phosphatase 1, regulatory subunit 137, ryanodine receptor 1, ryanodine receptor 1 (skeletal), ryanodine receptor type1, RYDR, RYR, RyR1, RYR-1, sarcoplasmic reticulum calcium release channel, Skeletal muscle calcium release channel, skeletal muscle ryanodine receptor, Skeletal muscle-type ryanodine receptor, SKRR, type 1-like ryanodine receptor | |
| RYR1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title