missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HPV HPV 6 Protein

Product Code. 15950009
Change view
Click to view available options
Quantity:
1 mg
100 μg
500 μg
Unit Size:
100µg
1mg
500µg
3 product options available for selection
Product selection table with 3 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15950009 100 μg 100µg
15970009 500 μg 500µg
15960009 1 mg 1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 3 options available.
3 options
This item is not returnable. View return policy
Product Code. 15950009 Supplier enQuireBio™ Supplier No. QP12309100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

A cDNA sequence encoding the HPV 6 was constructed and used to recombinantly synthesize the protein.

Specifications

Name HPV HPV 6 Protein
Quantity 100 μg
Regulatory Status Research Use Only
Endotoxin Concentration Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Product Type Recombinant Protein
Cross Reactivity HPV
Species E. coli
Protein Tag GST
Sequence VDVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVKRPAVSKASAAPKRKRAK
Buffer PBS and 3M Urea.
Purity or Quality Grade Protein is >95% pure as determined by 10% PAGE (coomassie staining).
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.