missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBED1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93265-0.02ml
This item is not returnable.
View return policy
Description
RBED1 Polyclonal antibody specifically detects RBED1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| RBED1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| C330008I15Rik, ELMO domain-containing protein 3, ELMO/CED-12 domain containing 3, FLJ21977, FLJ35601, liver-specific organic anion transporter 3TM12, LST3, MGC111036, organic anion transporter LST-3b, RBED1, RBM29, RNA binding motif and ELMO domain 1, RNA binding motif and ELMO/CED-12 domain 1, RNA binding motif protein 29, RNA-binding motif and ELMO domain-containing protein 1, RNA-binding motif protein 29, RNA-binding protein 29 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 290-381 of human ELMOD3 (NP_001128493.1). ATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLLKTLELYLARVSKGQASLLGAQKCYGPEAPPFKDLTFTGESDLQSHSSEGVWLI | |
| 0.02 mL | |
| Apoptosis | |
| 84173 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction