missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16178940

GCG Rabbit anti-Human, Polyclonal Antibody, Abnova™

Product Code. 16178940
Change view
Click to view available options
Quantity:
150 μg
Unit Size:
150µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16178940 150 μg 150µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16178940 Supplier Abnova Supplier No. PAB5057.150ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit polyclonal antibody raised against synthetic peptide of GCG.

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq

Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR

Specifications

Antigen GCG
Applications ELISA, Immunoprecipitation
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against synthetic peptide of GCG.
Dilution The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene GCG
Gene Alias GLP1/GLP2/GRPP
Gene Symbols GCG
Host Species Rabbit
Immunogen A synthetic peptide (conjugated with KLH) corresponding to human GCG.
Quantity 150 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2641
Target Species Human
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.