missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDGF-D/SCDGFB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 EUR - 589.00 EUR
Specifications
| Antigen | PDGF-D/SCDGFB |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18248461
|
Novus Biologicals
NBP2-55053 |
100 μL |
589.00 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18628766
|
Novus Biologicals
NBP2-55053-25ul |
25 μL |
415.00 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PDGF-D/SCDGFB Polyclonal specifically detects PDGF-D/SCDGFB in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PDGF-D/SCDGFB | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| IEGFMSTP036, Iris-expressed growth factor, PDGF-D, platelet derived growth factor D, SCDGF-BMGC26867, SCDGFBplatelet-derived growth factor D, spinal cord derived growth factor B, Spinal cord-derived growth factor B, spinal cord-derived growth factor-B | |
| PDGFD | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 80310 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASETNWESVTSSISGV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title