missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MGST3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
383.00 EUR - 611.00 EUR
Specifications
| Antigen | MGST3 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18331366
|
Bio-Techne
NBP3-17058-25UL |
25 μg |
383.00 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18358292
|
Bio-Techne
NBP3-17058-100UL |
100 μg |
611.00 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MGST3 Polyclonal antibody specifically detects MGST3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| MGST3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| EC 2.5.1.18, GST-III, microsomal glutathione S-transferase 3, microsomal glutathione S-transferase III, Microsomal GST-3, Microsomal GST-III | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: INVSKARKKYKVEYPIMYSTDPENGHIFNC | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 4259 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title