missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MGST3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17058-25UL
Additional Details : Weight : 0.00970kg
Description
MGST3 Polyclonal antibody specifically detects MGST3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
MGST3 | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
EC 2.5.1.18, GST-III, microsomal glutathione S-transferase 3, microsomal glutathione S-transferase III, Microsomal GST-3, Microsomal GST-III | |
This antibody was developed against Recombinant Protein corresponding to amino acids: INVSKARKKYKVEYPIMYSTDPENGHIFNC | |
25 μg | |
Primary | |
Human | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
4259 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |