missing translation for 'onlineSavingsMsg'
Learn More

MGST3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-17058-25UL

Additional Details : Weight : 0.00970kg

Product Code. 18331366

Estimated Shipment: 26-08-2024
to see stock.

Description

MGST3 Polyclonal antibody specifically detects MGST3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	MGST3
Classification	Polyclonal
Dilution	Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias	EC 2.5.1.18, GST-III, microsomal glutathione S-transferase 3, microsomal glutathione S-transferase III, Microsomal GST-3, Microsomal GST-III
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: INVSKARKKYKVEYPIMYSTDPENGHIFNC
Quantity	25 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	4259
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description