missing translation for 'onlineSavingsMsg'
Learn More

MGST3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17058-25UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331366

  • 360.68 EUR / 25µL
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

MGST3 Polyclonal antibody specifically detects MGST3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

MGST3
Polyclonal
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
EC 2.5.1.18, GST-III, microsomal glutathione S-transferase 3, microsomal glutathione S-transferase III, Microsomal GST-3, Microsomal GST-III
This antibody was developed against Recombinant Protein corresponding to amino acids: INVSKARKKYKVEYPIMYSTDPENGHIFNC
25 μg
Primary
Human
Purified
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
4259
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG
Suggestions de produits

Suggestions de produits

Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions