missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lumican Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00 EUR
Specifications
| Antigen | Lumican |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Lumican Polyclonal specifically detects Lumican in Human, Rabbit samples. It is validated for Western Blot.Specifications
| Lumican | |
| Polyclonal | |
| Rabbit | |
| NP_002336 | |
| 4060 | |
| Synthetic peptide directed towards the middle region of human LUM. Peptide sequence AFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KSPG lumican, lumican, lumican proteoglycan, SLRR2DLDCKeratan sulfate proteoglycan lumican | |
| LUM | |
| IgG | |
| 37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title