missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Isoleucyl tRNA synthetase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35104-20ul
This item is not returnable.
View return policy
Description
Isoleucyl tRNA synthetase Polyclonal antibody specifically detects Isoleucyl tRNA synthetase in Human samples. It is validated for ELISA,Western Blot
Specifications
| Isoleucyl tRNA synthetase | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| EC 6.1.1, EC 6.1.1.5, FLJ20736, IARS1, ILERS, ILRS, IRS, isoleucine tRNA ligase 1, cytoplasmic, Isoleucine--tRNA ligase, isoleucyl-tRNA synthetase, isoleucyl-tRNA synthetase, cytoplasmic, PRO0785 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1158-1262 of human Isoleucyl tRNA synthetase (NP_002152.2).,, Sequence:, SAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF | |
| 20 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 3376 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction