missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ID3 Antibody (2H8), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00003399-M03
This item is not returnable.
View return policy
Description
ID3 Monoclonal antibody specifically detects ID3 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
| ID3 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| BHLHB25, bHLHb251R21, Class B basic helix-loop-helix protein 25, DNA-binding protein inhibitor ID-3, HEIR1, HEIR-1, Helix-loop-helix protein HEIR-1, ID-like protein inhibitor HLH 1R21, Inhibitor of DNA binding 3, inhibitor of DNA binding 3, dominant negative helix-loop-helix protein | |
| ID3 (NP_002158, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV | |
| 0.1 mg | |
| Cancer, Cell Cycle and Replication, Prostate Cancer | |
| 3399 | |
| Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA, Immunocytochemistry | |
| 2H8 | |
| Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence | |
| NP_002158 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering