missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ IBA1 Polyclonal Antibody
GREENER_CHOICE

Product Code. 16364675 Shop All Thermo Scientific Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
Product Code. Quantity unitSize
16364675 100 μg 100µg
1 options
This item is not returnable. View return policy

Product Code. 16364675

Brand: Invitrogen™ PA595409

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HEL whole cell, human THP-1 whole cell. IHC: human spleen tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Ionized calcium-binding adapter molecule 1 (IBA1), also known by its gene name AIF1, is a protein expressed predominantly by microglia in the brain and spinal cord. This protein belongs to the EF-hand calcium-binding protein family and plays a crucial role in microglial activation and migration in response to brain injury or neuroinflammation. IBA1's function is integral to microglial motility and phagocytic activity, facilitating the cellular response to pathogenic stimuli and promoting tissue homeostasis and repair in the central nervous system. IBA1 serves as a reliable marker for activated microglia in various neurological disorders, including Alzheimer's disease, Parkinson's disease, and multiple sclerosis, where increased expression correlates with disease progression and severity. The protein's structural features enable it to bind calcium ions, inducing conformational changes that activate signaling pathways essential for microglial function. Its expression is highly regulated by inflammatory cytokines, underpinning its role in neuroimmune responses. Due to its specific expression in microglia during pathological conditions, IBA1 is widely used in research as a marker to study microglial status and activity, and it remains a focal point for understanding microglial involvement in neurodegenerative diseases.
TRUSTED_SUSTAINABILITY

Specifications

Antigen IBA1
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene AIF1
Gene Accession No. P55008
Gene Alias AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific
Gene Symbols AIF1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 199
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.