missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212589

Invitrogen™ Human ZNF331 (aa 61-131) Control Fragment Recombinant Protein

Product Code. 30212589
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30212589 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30212589 Supplier Invitrogen™ Supplier No. RP105256

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66560 (PA5-66560. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF331 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF331 may be involved in transcriptional regulation. It may play a role in spermatogenesis. Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form one family of zinc finger proteins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NQX6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55422
Name Human ZNF331 (aa 61-131) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C2H2-like zinc finger protein rearranged in thyroid adenomas; DKFZp686L0787; KRAB zinc finger protein; RITA; Zinc finger protein 331; zinc finger protein 361; Zinc finger protein 463; ZNF331; ZNF361; ZNF463
Common Name ZNF331
Gene Symbol ZNF331
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENSF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.