missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208564

Invitrogen™ Human ZBTB9 (aa 292-392) Control Fragment Recombinant Protein

Product Code. 30208564
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30208564 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30208564 Supplier Invitrogen™ Supplier No. RP95059

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57804 (PA5-57804. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ZBTB family of proteins is comprised of diverse zinc finger proteins that also contain a BTB (BR-C, ttk and bab) domain. ZBTB9, also known as ZNF919, is present in multiple tissues, and is highly expressed in the cytoplasm of the placenta. While little is known about ZBTB9, other ZBTB proteins, such as ZBTB4 bind methylated DNA and repress transcription. Another ZBTB proteins, ZBTB7A, has been implicated as a proto-oncogene whose overexpression contributes to malignancy in breast cancer, suggesting that ZBTB9 may act as a transcriptional repressor or be involved in tumorigenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96C00
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 221504
Name Human ZBTB9 (aa 292-392) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3930402F13Rik; DASS-97D12.7; Zbtb9; zinc finger and BTB domain containing 9; zinc finger and BTB domain-containing protein 9; ZNF919
Common Name ZBTB9
Gene Symbol ZBTB9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PKEEISGSGTQPGGAKEETKVFSGGDTEGNGELGFLLPSGPGPTSGGGGPSWKPVDLHGNEILSGGGGPGGAGQAVHGPVKLGGTPPADGKRFGCLCGKRF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.