missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203079

Invitrogen™ Human WSB1 (aa 27-157) Control Fragment Recombinant Protein

Product Code. 30203079
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203079

Brand: Invitrogen™ RP102067

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51884 (PA5-51884. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WSB1 (WD repeat and SOCS box-containing 1), also known as SWIP1, is a 421 amino acid protein that contains one SOCS box domain and six WD repeats. Expressed as multiple alternatively spliced isoforms, WSB1 is thought to function as part of an SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex that mediates the ubiquitination and proteasomal degradation of target proteins, such as DIO2. Overexpression of WSB1 is implicated in pancreatic cancer progression, suggesting a role for WSB1 in carcinogenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y6I7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26118
Name Human WSB1 (aa 27-157) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110056B13Rik; 2700038M07Rik; SOCS box-containing WD protein SWiP-1; SWIP1; WD repeat and SOCS box containing 1; WD repeat and SOCS box-containing 1; WD repeat and SOCS box-containing protein 1; WD repeat and SOCS box-containing protein 1-like protein; WD-40-repeat-containing protein with a SOCS box 1; WSB1; WSB-1
Common Name WSB1
Gene Symbol WSB1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence APFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.