missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human WIZ (aa 1272-1394) Control Fragment Recombinant Protein

Product Code. 30202564
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30202564 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30202564 Supplier Invitrogen™ Supplier No. RP104572

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82844 (PA5-82844. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WIZ, also known as ZNF803, was initially identified in a mouse cerebellum cDNA library screen and its message was found to be expressed in the granule cell layers of the cerebellum as well as in the dentate gyrus and olfactory bulb. Later analysis indicates however that WIZ is ubiquitously expressed. WIZ is a nuclear protein that co-localizes with G9a, a histone methyltransferase responsible for mono- and dimethylation of H3K9 at euchromatic regions. WIZ can also associate with CtBP family proteins, known to be transcriptional co-repressors, and has been suggested to link G9a/GLP complexes to the CtBP co-repressor machinery, possibly regulating complex stability and gene silencing.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95785
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 58525
Name Human WIZ (aa 1272-1394) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Protein Wiz; widely interspaced zinc finger motifs; widely-interspaced zinc finger motifs; widely-interspaced zinc finger-containing protein; Wiz; WIZ zinc finger; zinc finger protein 803; ZNF803
Common Name WIZ
Gene Symbol WIZ
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LKKKSKPCLIKKEPPAGDLAPALAEDGPPTVAPGPVQSPLPLSPLAGRPGKPGAGPAQVPRELSLTPITGAKPSATGYLGSVAAKRPLQEDRLLPAEVKAKTYIQTELPFKAKTLHEKTSHSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.