missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203260

Invitrogen™ Human VLK (aa 407-487) Control Fragment Recombinant Protein

Product Code. 30203260
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30203260 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30203260 Supplier Invitrogen™ Supplier No. RP95072

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110916 (PA5-110916. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VLK was identified as a novel protein kinase that was induced after the differentiation of cultured embryonic stem cells into mesendoderm. It has no homologs in invertebrates, but is highly conserved in vertebrate species although it does not belong to any known protein kinase groups. VLK is initially expressed in E-cadherin-positive anterior visceral endoderm and mesendoderm, but its expression is later confined to E-cadherin-negative mesenchyme. It is enriched in the Golgi apparatus and is thought to regulate the rate of protein export from the Golgi. Targeted disruption of VLK in mice leads to a defect in lung development and neonatal lethality. It has been suggested that mutations in VLK may be associated with the allergic condition atopy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q504Y2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 91461
Name Human VLK (aa 407-487) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Adtk1; AI115348; AW548124; ESTM17; Extracellular tyrosine-protein kinase PKDCC; MAd1; Pkdcc; protein kinase domain containing, cytoplasmic; protein kinase domain containing, cytoplasmic homolog; protein kinase domain-containing protein, cytoplasmic; Protein kinase-like protein SgK493; RGD1311939; SGK493; Sugen kinase 493; vertebrate lonesome kinase; Vlk; X83346
Common Name VLK
Gene Symbol PKDCC
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.