missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UBR1 (aa 1194-1311) Control Fragment Recombinant Protein

Product Code. 30205405
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30205405 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30205405 Supplier Invitrogen™ Supplier No. RP108823

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ELK1 is a component of the ternary complex that binds the serum response element (SRE) and mediates gene activity in response to serum and growth factors. ELK1 is phosphorylated by MAP kinase pathways at a cluster of S/T motifs at its C-terminus. Phosphorylation at these sites, particularly Ser383, is critical for transcriptional activation by ELK1. ELK1 appears to be a direct target of activated MAP kinase. Biochemical studies indicate that ELK1 is a good substrate for MAP kinase, the kinetics of ELK1 phosphorylation and activation correlate with MAP kinase activity, and interfering mutants of MAP kinase block ELK1 activation in vivo. ELK1 is a nuclear target for the ras-raf-MAPK signaling cascade. Alternatively spliced transcript variants encoding the same protein have been found for ELK1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IWV7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 197131
Name Human UBR1 (aa 1194-1311) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI504731; E3 alpha; E3 ubiquitin-protein ligase UBR1; E3a ligase; JBS; LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UBR1; MGC142065; MGC142067; N-recognin-1; RGD1562326; RING-type E3 ubiquitin transferase UBR1; ubiquitin ligase E3 alpha-I; ubiquitin protein ligase E3 component n-recognin 1; ubiquitin-protein ligase e3 componen n-recognin; ubiquitin-protein ligase E3-alpha; ubiquitin-protein ligase E3-alpha-1; Ubiquitin-protein ligase E3-alpha-I; Ubr1
Common Name UBR1
Gene Symbol UBR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EYLCPLCKSLCNTVIPIIPLQPQKINSENADALAQLLTLARWIQTVLARISGYNIRHAKGENPIPIFFNQGMGDSTLEFHSILSFGVESSIKYSNSIKEMVILFATTIYRIGLKVPPD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.