missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211884

Invitrogen™ Human UBE2L3 (aa 1-64) Control Fragment Recombinant Protein

Product Code. 30211884
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30211884 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30211884 Supplier Invitrogen™ Supplier No. RP100491

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111218 (PA5-111218. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P68036
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7332
Name Human UBE2L3 (aa 1-64) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C79827; E2 ubiquitin-conjugating enzyme L3; E2-F1; L-UBC; UBCE7; UBCH7; UbcM4; Ube2l3; Ubiquitin carrier protein L3; ubiquitin conjugating enzyme E2 L3; ubiquitin conjugating enzyme E2L 3; ubiquitin-conjugating enzyme 7; ubiquitin-conjugating enzyme E2 L3; Ubiquitin-conjugating enzyme E2-F1; ubiquitin-conjugating enzyme E2L 3; ubiquitin-conjugating enzyme UBCH7; ubiquitin-protein ligase L3; Unknown (protein for MGC:127956)
Common Name UBE2L3
Gene Symbol UBE2L3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.