missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207834

Invitrogen™ Human UBE2G2 (aa 58-162) Control Fragment Recombinant Protein

Product Code. 30207834
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207834

Brand: Invitrogen™ RP102077

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51896 (PA5-51896. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P60604
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7327
Name Human UBE2G2 (aa 58-162) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110003O05Rik; D10Xrf369; E2 ubiquitin-conjugating enzyme G2; EGK_13178; UBC7; Ubc7p; UBE2G2; Ubiquitin carrier protein G2; ubiquitin conjugating enzyme 7; ubiquitin conjugating enzyme E2 G2; ubiquitin conjugating enzyme E2G 2; ubiquitin conjugating enzyme G2; ubiquitin-conjugating enzyme 7 homolog; ubiquitin-conjugating enzyme E2 G2; ubiquitin-conjugating enzyme E2G 2; ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7); ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast); ubiquitin-protein ligase G2
Common Name UBE2G2
Gene Symbol UBE2G2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.