missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRPML3 (aa 146-244) Control Fragment Recombinant Protein

Product Code. 30198777
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30198777 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30198777 Supplier Invitrogen™ Supplier No. RP91207

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53725 (PA5-53725. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Expressed in the cochlea; particularly in the inner and outer hair cells. Defects in Mcoln3 are the cause of the varitin-waddler (Va) phenotype. Classical Va mice exhibit early-onset hearing loss, vestibular defects, pigmentation abnormalities and perinatal lethality. The phenotype varitin-waddler Jackcon (Va-J), which arose in a cross segregating for Va, is similar but less severe. Belongs to the transient receptor family, polycystin subfamily.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TDD5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55283
Name Human TRPML3 (aa 146-244) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6720490O21Rik; FLJ11006; FLJ36629; MCLN3; Mcoln3; Mcoln3 mucolipin 3; MGC124245; MGC124246; MGC71509; mucolipin 3; mucolipin-3; Transient receptor potential channel mucolipin 3; TRPML3; TRP-ML3; Va; varitint-waddler
Common Name TRPML3
Gene Symbol MCOLN3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.