missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TMC7 (aa 27-143) Control Fragment Recombinant Protein

Product Code. 30203933
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203933

Brand: Invitrogen™ RP90832

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56158 (PA5-56158. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMC7 (Transmembrane channel-like protein 7) is a 723 amino acid protein that is a member of the TMC protein family. All TMC genes encode transmembrane proteins with intracellular amino- and carboxy- termini and at least eight membrane spanning domains. Therefore, TMC7 is a multi-pass membrane protein that may regulate or function as an ion channel or transporter. The gene encoding TMC7 maps to human chromosome 16, which encodes over 900 genes and comprises nearly 3% of the human genome. The GAN gene is located on chromosome 16 and, with mutation, may lead to giant axonal neuropathy, a nervous system disorder characterized by increasing malfunction with growth. The rare disorder Rubinstein-Taybi syndrome is also associated with chromosome 16, as is Crohn's disease, which is a gastrointestinal inflammatory condition.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7Z402
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79905
Name Human TMC7 (aa 27-143) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700030H01Rik; C230064B05; C630024K23Rik; RGD1564267; Tmc7; transmembrane channel like 7; transmembrane channel-like 7; transmembrane channel-like gene family 7; transmembrane channel-like protein 7
Common Name TMC7
Gene Symbol TMC7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LDSSCFSSPPVNFLQELPSYRSIARRRTTVHSRDKQSGTLLKPTDSYSSQLEDRIAENLSSHSLRNYALNISEKRRLRDIQETQMKYLSEWDQWKRYSSKSWKRFLEKAREMTTHLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.