missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206937

Invitrogen™ Human TIA-1 (aa 340-380) Control Fragment Recombinant Protein

Product Code. 30206937
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206937

Brand: Invitrogen™ RP106742

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Noggin is involved in numerous developmental processes, such as neural tube fusion and joint formation. The morphogenesis of organs is initiated by a downgrowth from a layer of epithelial stem cells. This process is achieved through the receipt of signals from 1) a WNT protein (WNT3A) to stabilize beta-catenin; and 2) Noggin, which is a bone morphogenetic protein inhibitor. Noggin mutations in unrelated families with proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1) have been identified, which have multiple joint fusion as their principal defect.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P31483
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7072
Name Human TIA-1 (aa 340-380) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310050N03Rik; AI256674; cytotoxic granule-associated RNA binding protein 1; cytotoxic granule-associated RNA-binding protein 1; mTIA-1; Nucleolysin TIA-1; nucleolysin TIA-1 isoform p40; p40 TIA 1; p40-TIA-1; p40-TIA-1 (containing p15-TIA-1); RNA-binding protein TIA-1; T-cell-restricted intracellular antigen-1; Tia; TIA 1; TIA1; TIA-1; TIA1 cytotoxic granule-associated RNA binding protein; TIA1 protein; TIAL1; TIAR; WDM
Common Name TIA-1
Gene Symbol TIA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.