missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211930

Invitrogen™ Human TGM1 (aa 692-771) Control Fragment Recombinant Protein

Product Code. 30211930
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211930

Brand: Invitrogen™ RP110018

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P22735
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7051
Name Human TGM1 (aa 692-771) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310004J08Rik; ARCI1; Epidermal TGase; ICR2; K polypeptide; K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase; KTG; LI; LI1; LOW QUALITY PROTEIN: protein-glutamine gamma-glutamyltransferase K; Protein-glutamine gamma-glutamyltransferase K; protein-glutamine-gamma-glutamyltransferase; TG K; TG(K); TGASE; TGase 1; TGase K; Tgase1; TGase-1; TGK; TGM1; tranglutaminase 1; transglutaminase 1; transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase); transglutaminase 1 isoform; transglutaminase 1, K polypeptide; transglutaminase K; transglutaminase type 1; transglutaminase type I; transglutaminase, keratinocyte; transglutaminase-1
Common Name TGM1
Gene Symbol TGM1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.