missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199994

Invitrogen™ Human SUPT7L (aa 50-133) Control Fragment Recombinant Protein

Product Code. 30199994
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199994

Brand: Invitrogen™ RP105265

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66610 (PA5-66610. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SUPT7L is a protein subunit of the human STAGA complex (SPT3)/TAF9/GCN5 acetyltransferase complex), which is a chromatin-modifying multiprotein complex.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O94864
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9913
Name Human SUPT7L (aa 50-133) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610524B01Rik; 6030455L14Rik; Adenocarcinoma antigen ART1; KIAA0764; RGD1562206; SPT7 like, STAGA complex gamma subunit; SPT7 like, STAGA complex subunit gamma; SPT7L; SPT7-like STAGA complex gamma subunit; SPTF-associated factor 65 gamma; STAF65; STAF65(gamma); STAF65G; STAF65gamma; STAGA complex 65 gamma subunit; STAGA complex 65 subunit gamma; STAGA complex 65 subunit gamma-like; suppressor of Ty 7 (S. cerevisiae)-like; suppressor of Ty 7-like; SUPT7H; SUPT7L; Unknown (protein for MGC:137593)
Common Name SUPT7L
Gene Symbol SUPT7L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.