missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213257

Invitrogen™ Human SLCO2B1 (aa 472-564) Control Fragment Recombinant Protein

Product Code. 30213257
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213257

Brand: Invitrogen™ RP101764

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54258 (PA5-54258. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O94956
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11309
Name Human SLCO2B1 (aa 472-564) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI060904; AI852653; hypothetical protein LOC557480; im:7158298; KIAA0880; moat1; multispecific organic anion transporter 1; Oatp2b1; OATPB; OATP-B; OATP-RP2; Organic anion transporter B; organic anion transporter moatp1; Organic anion transporter polypeptide-related protein 2; organic anion transporting polypeptide 2b1; organic anion-transporting polypeptide 2B1; SLC21A9; SLCO/OATP2B1; Slco2b1; solute carrier anion transporting family member 2b1; solute carrier family 21 (organic anion transporter), member 9; solute carrier family 21 member 9; Solute carrier organic anion transporter family member 2B1; solute carrier organic anion transporter family, member 2B1; wu:fi40d02; zgc:123236
Common Name SLCO2B1
Gene Symbol SLCO2B1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.