missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207125

Invitrogen™ Human SLC17A1 (aa 39-79) Control Fragment Recombinant Protein

Product Code. 30207125
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207125

Brand: Invitrogen™ RP106288

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65625 (PA5-65625. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC17A1 (Solute Carrier Family 17 Member 1) is a Protein Coding gene. Diseases associated with SLC17A1 include Gout and Hyperuricemia. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Uricosurics Pathway, Pharmacodynamics. Gene Ontology (GO) annotations related to this gene include symporter activity and phosphate ion transmembrane transporter activity. An important paralog of this gene is SLC17A2. Also, it is involved in cotransport of sodium and phosphate.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14916
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6568
Name Human SLC17A1 (aa 39-79) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Na(+)/PI cotransporter 1; Na/Pi-4; Napi1; Napi-1; Npt1; NPT-1; OATV1; organic anion transporter OATv1; renal Na(+)-dependent phosphate cotransporter 1; Renal sodium-dependent phosphate transport protein 1; renal sodium-phosphate transport protein 1; Slc17a1; sodium phosphate transporter; sodium/phosphate cotransporter 1; sodium/phosphate type I cotransporter; sodium-dependent phosphate transport protein 1; sodium-dependent phosphate/anion cotransporter; solute carrier family 17 (organic anion transporter), member 1; solute carrier family 17 (sodium phosphate), member 1; solute carrier family 17 (sodium/hydrogen exchanger), member 1; solute carrier family 17 (vesicular glutamate transporter), member 1; solute carrier family 17 member 1; solute carrier family 17 vesicular glutamate transporter), member 1
Common Name SLC17A1
Gene Symbol Slc17a1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.