missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210148

Invitrogen™ Human SLC12A3 (aa 844-988) Control Fragment Recombinant Protein

Product Code. 30210148
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210148

Brand: Invitrogen™ RP102376

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55969 (PA5-55969. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a renal thiazide-sensitive sodium-chloride cotransporter that is important for electrolyte homeostasis. This cotransporter mediates sodium and chloride reabsorption in the distal convoluted tubule.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P55017
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6559
Name Human SLC12A3 (aa 844-988) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI035291; chemokine (C-C); CKb10; CK-beta-10; MCP-4; MGC17134; Na-Cl cotransporter; NaCl electroneutral thiazide-sensitive cotransporter; Na-Cl symporter; Ncc; NCC1; NCC-1; NCCT; SCYA13; SCYL1; si:ch211-122c9.4; SLC12A3; sodium chloride cotransporter; solute carrier family 12 (sodium/chloride transporter), member 3; solute carrier family 12 (sodium/chloride transporters), member 3; solute carrier family 12 member 3; solute carrier family 12, member 3; thiazide-sensitive Na-Cl cotransporter; thiazide-sensitive sodium chloride cotransporter; thiazide-sensitive sodium-chloride cotransporter; TSC; wu:fj83c03
Common Name SLC12A3
Gene Symbol Slc12a3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.