missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SIRT3 (aa 104-227) Control Fragment Recombinant Protein

Product Code. 30204178
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30204178 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30204178 Supplier Invitrogen™ Supplier No. RP88968

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIRT3 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The SIRT3 is included in class I of the sirtuin family.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NTG7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23410
Name Human SIRT3 (aa 104-227) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310003L23Rik; AI848213; HGNC:14931; hSIRT3; mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase; mitochondrial protein lysine deacetylase; mSIR2L3; NAD-dependent deacetylase sirtuin-3; NAD-dependent deacetylase sirtuin-3, mitochondrial; NAD-dependent protein deacetylase sirtuin-3; NAD-dependent protein deacetylase sirtuin-3, mitochondrial; regulatory protein SIR2 homolog 3; silent mating type information regulation 2, (S.cerevisiae, homolog)-like 3; silent mating type information regulation 2, S.cerevisiae, homolog 3; Sir2l3; sir2-like 3; SIR2-like protein 3; SIRT3; SIRT3L mitochondrial; sirtuin 3; sirtuin type 3
Common Name SIRT3
Gene Symbol SIRT3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FSVGASSVVGSGGSSDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.