missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SFRP4 (aa 33-172) Control Fragment Recombinant Protein

Product Code. 30211971
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30211971 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30211971 Supplier Invitrogen™ Supplier No. RP88742

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52679 (PA5-52679. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Secreted Frizzled-Related Proteins (sFRPs) are a family of glycosylated Wnt antagonists characterized by a conserved cysteine-rich domain that shares homology with the cysteine-rich, extracellular domain Frizzled proteins use for the binding of Wnt proteins and receptors. Lacking the transmembrane and intracellular domains of the Frizzled proteins, sFRPs function as soluble modulators of the Wnt signaling pathway through the direct binding of Wnt proteins to this cysteine-rich domain, and the resultant inhibition of Wnt receptor binding and signaling capabilities. sFRP-4 is widely distributed in a variety of embryonic and adult tissues where it can function as a circulating antiangiogenic factor, a potent proapoptotic factor, an inhibitor of insulin secretion, and a suppressor of both tumor growth and metastatic potential through disruption of the Wnt signaling pathway. Research has demonstrated the existence of a direct correlation between the downregulation and/or absence of circulating sFRP-4 and the progression of several cancer types, including ovarian, endometrial, prostate and lung. Upregulation of circulating sFRP-4 has been linked to the deterioration of glucose metabolism in the case of type 2 diabetes, as well as the suppression of the keratinocyte hyperproliferation and epidermal hyperlasia that are definitive of psoriasis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6FHJ7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6424
Name Human SFRP4 (aa 33-172) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Ddc4; DDC-4 protein; Frizzled protein, human endometrium; frizzled related protein; frizzled-related protein; frizzled-related protein 4; FRP; FRP-4; FRPHE; MGC26498; secreted frizzled related protein 4; secreted frizzled-related protein 4; secreted frizzled-related protein 4; secreted frizzled-related protein 4; secreted frizzled-related sequence protein 4; Sfrp4; sFRP-4
Common Name SFRP4
Gene Symbol SFRP4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.