missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211903

Invitrogen™ Human SCYL2 (aa 308-448) Control Fragment Recombinant Protein

Product Code. 30211903
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211903

Brand: Invitrogen™ RP91441

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54317 (PA5-54317. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SCYL2 is a component of AP2-containing clathrin coated structures at the plasma membrane or of endocytic coated vesicles. SCYL2 is a probable serine/threonine-protein kinase that phosphorylates, in vitro, the beta2-subunit of the plasma membrane adapter complex AP2 and other proteins in presence of poly-L-lysine. SCYL2 may also regulate clathrin-dependent trafficking between the TGN and/or the endosomal system.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6P3W7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55681
Name Human SCYL2 (aa 308-448) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AU015688; AW536445; BC030932; Coated vesicle-associated kinase of 104 kDa; CVAK104; D10Ertd802e; KIAA1360; RGD1305665; SCY1 like pseudokinase 2; SCY1-like 2; SCY1-like 2 (S. cerevisiae); SCY1-like protein 2; SCY1-like, kinase-like 2; SCYL2
Common Name SCYL2
Gene Symbol Scyl2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.