missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human S100A10 (aa 1-67) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP102006

Product Code. 30200476

  • 271.00 EUR / 100µL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Description

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82082 (PA5-82082. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The S-100 family of calcium-activated proteins interact with a range of target proteins to modulate biological signaling pathways. Numerous cancer cell lines overexpress the plasminogen receptor S-100A10 on the extracellular cell surface, where it forms a heterotetrameric complex with Annexin II, though this association is not required for plasma membrane localization or binding and activation of plasminogen. Additionally, S-100A10 acts as a cellular chaperone for hepatitis B (Hep B) virus polymerase. Hep B virus polymerase normally localizes to the cytoplasm only, though in the presence of S-100A10 a portion relocates to the nucleus, implying a role for S-100A10 and intracellular calcium in the process of viral replication.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

P60903
Blocking Assay, Control
6281
100 μL
42 C; AA409961; AL024248; Annexin II; annexin II ligand; annexin II ligand, calpactin I, light polypeptide; annexin II tetramer (AIIt) p11 subunit; AN x 2 L; AN x 2 LG; Ca[1 ]; CAL12; Cal1l; calcium binding protein A11 (calgizzarin); calpactin I light chain; Calpactin-1 light chain; cellular ligand of annexin II; CLP11; GP11; MGC111133; MGC133268; Nerve growth factor-induced protein 42 C; OTTHUMP00000015270; P PRSS26; p10; p10 protein; P11; p11 subunit; Protein S100 A10; Protein S100-A10; S100 calcium binding protein A10; S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S100 calcium binding protein A10 (calgizzarin); S100 calcium binding protein A10 (calpactin); S100 calcium-binding protein A10; S100 calcium-binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S-100 related protein, clone 42 C; S100a10
S100A10
Human
His-ABP-tag
-20°C, Avoid Freeze/Thaw Cycles
Liquid
≥5.0 mg/mL
1 M urea, PBS with no preservative; pH 7.4
Human S100A10 (aa 1-67) Control Fragment
RUO
S100A10
Unconjugated
Recombinant
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV
E. coli
>80% by SDS-PAGE and Coomassie blue staining
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.