missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RUNX1T1 (aa 404-450) Control Fragment Recombinant Protein

Product Code. 30213168
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213168

Brand: Invitrogen™ RP104886

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111303 (PA5-111303. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RUNX1T1 is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. The protein encoded by this gene is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Several transcript variants encoding multiple isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q06455
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 862
Name Human RUNX1T1 (aa 404-450) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias acute myelogenous leukemia 1 translocation 1 protein; acute myelogenous leukemia 1 translocation 1, cyclin-D related; AML1-MTG8; AML1T1; Cbfa2t1; CBFA2T1 identified gene homolog; CBFA2T1 isoform r1t1-11a61; CBFA2T1 isoform r1t1-11a62; CBFA2T1 isoform r1t1-11a63; CBFA2T1 isoform r1t1-11a64; CBFA2T1 isoform r1t1-11a65; CBFA2T1 isoform r1t1-7a47; CBFA2T1 isoform r1t1-7a48; CBFA2T1 isoform r1t1-7a49; CBFA2T1 isoform r1t1-7a50; CBFA2T1 isoform r1t1-7a51; CBFA2T1 isoform r1t1-7a52; CBFA2T1 isoform r1t1-7d53; CBFA2T1 isoform r1t1-7d54; CBFA2T1 isoform r1t1-7d55; CBFA2T1 isoform r1t1-7d56; CBFA2T1 isoform r1t1-8a57; CBFA2T1 isoform r1t1-8a58; CBFA2T1 isoform r1t1-8a59; CBFA2T1 isoform r1t1-8a60; Cbfa2t1h; CDR; core-binding factor, runt domain, alpha subunit 2, translocated to, 1; core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclin D-related; cyclin D-related; Cyclin-D-related protein; Eight twenty one protein; ETO; LOW QUALITY PROTEIN: protein CBFA2T1; MGC2796; MTG8; MTG8b; myeloid translocation gene on 8q22; protein CBFA2T1; protein CBFA2T1; LOW QUALITY PROTEIN: protein CBFA2T1; protein CBFA2T1-like; Protein ETO; Protein MTG8; runt related transcription factor 1; translocated to, 1 (cyclin D related); runt-related transcription factor 1; translocated to, 1 (cyclin D-related); RUN x 1 partner transcriptional co-repressor 1; RUN x 1 translocation partner 1; Run x 1t1; si:ch211-232j17.1; translocated to, 1; wu:fi14b07; zgc:154044; zinc finger MYND domain-containing protein 2; ZMYND2
Common Name RUNX1T1
Gene Symbol RUNX1T1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.