missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199380

Invitrogen™ Human PRPF18 (aa 62-144) Control Fragment Recombinant Protein

Product Code. 30199380
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199380

Brand: Invitrogen™ RP97130

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58031 (PA5-58031. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRPF18 (pre-mRNA-splicing factor 18), also known as HPRP18, is a 342 amino acid protein that localizes to nuclear speckles and plays a role in the second step of pre-mRNA splicing. A member of the PRP18 family, PRPF18 contains seven WD repeats and exists as two alternatively spliced isoforms which are encoded by a gene located on human chromosome 10p13. Chromosome 10 contains over 800 genes and 135 million nucleotides. PTEN is an important tumor suppressor gene located on chromosome 10 and, when defective, causes a genetic predisposition to cancer development known as Cowden syndrome. Other chromosome 10 associated disorders include Cockayne syndrome, tetrahydrobiopterin deficiency and trisomy 10.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99633
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8559
Name Human PRPF18 (aa 62-144) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810441A10Rik; HPRP18; HPRP18 homolog; Kcrf; Potassium channel regulatory factor; Pprf18; pre-mRNA processing factor 18; pre-mRNA-splicing factor 18; Prp18; PRP18 homolog; PRP18 pre-mRNA processing factor 18 homolog; PRP18 pre-mRNA processing factor 18 homolog (yeast); PRP18 pre-mRNA processing factor 18 homolog(PRPF18); Prpf18
Common Name PRPF18
Gene Symbol PRPF18
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SNPVLELELAEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKAALDKIDQQYLNEIVG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.