missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207885

Invitrogen™ Human POFUT1 (aa 66-164) Control Fragment Recombinant Protein

Product Code. 30207885
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30207885 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30207885 Supplier Invitrogen™ Supplier No. RP106976

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

POFUT1, an endoplasmic reticulum-residing member of the glycosyltransferase O-Fuc family, adds O-fucose through an O-glycosidic linkage to conserved serine or threonines in epidermal growth factor-like repeats of several cell surface and secreted proteins. Unlike its homolog POFUT2, POFUT1 can also catalyze the transfer of fucose to thrombospondin type 1 repeats. Many of the substrates of POFUT1 are involved in ligand-induced receptor signaling. One such protein is Notch; mouse ES cells lacking POFUT have normal levels of Notch receptors at the cell surface, but these receptors do not bind Notch ligands or exhibit Notch signaling.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H488
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23509
Name Human POFUT1 (aa 66-164) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DDD2; FUT12; GDP-fucose protein O-fucosyltransferase 1; KIAA0180; mKIAA0180; o-fucosyltransferase protein; O-Fuc-T; OFUCT1; O-FucT-1; O-FucT-1 A; O-FucT-1 b; O-FUT; peptide-O-fucosyltransferase 1; Pofut1; pofut1 {ECO:0000312; protein O-fucosyltransferase 1; protein O-fucosyltransferase 1 isoform 1 precursor; protein O-fucosyltransferase 1 A; protein O-fucosyltransferase 1 b; protein-O-fucosyltransferase 1; RGD:1303001}; zgc:110472
Common Name POFUT1
Gene Symbol POFUT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.