missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206659

Invitrogen™ Human PKM1/PKM2 (aa 93-203) Control Fragment Recombinant Protein

Product Code. 30206659
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206659

Brand: Invitrogen™ RP91716

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Several alternatively spliced transcript variants encoding a few distinct isoforms have been reported.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P14618
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5315
Name Human PKM1/PKM2 (aa 93-203) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA414905; AL024370; AL024424; ATP:pyruvate 2-o-phosphotransferase; CTHBP; Cytosolic thyroid hormone-binding protein; epididymis secretory protein Li 30; HEL-S-30; m2pk; muscle pyruvate kinase; OIP3; OIP-3; OPA-interacting protein 3; p58; Pk., muscle type; PK2; Pk.-2; Pk3; Pk.-3; PKM; PKM12; PKM2; Pykm; pyruvate kinase; pyruvate kinase 2/3; pyruvate kinase 3; pyruvate kinase isozymes M1/M2; pyruvate kinase M1/2; Pyruvate kinase muscle isozyme; Pyruvate kinase PKM; pyruvate kinase, muscle; TCB; THBP1; Thyroid hormone-binding protein 1; thyroid hormone-binding protein, cytosolic; tumor M2-Pk.
Common Name PKM1/PKM2
Gene Symbol PKM
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.