missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30193570

Invitrogen™ Human PDGF-C (aa 183-265) Control Fragment Recombinant Protein

Product Code. 30193570
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193570

Brand: Invitrogen™ RP89554

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82379 (PA5-82379. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sphingosine Kinase 2 (Sphk2) catalyzes the phosphorylation of sphingosine to sphingosine 1 phosphate (S1P), an important signaling molecule with intra- and extracellular functions. Inside the cell S1P acts as a signaling molecule like other sphingolipid metabolites like ceramide and sphingosine. S1P has been implicated in regulating cell differentiation, calcium mobilization from intracellular stores, and apoptosis. The cell surface receptors for S1P are the EDG family of G protein-coupled receptors (S1P Receptors).These receptors couple to multiple G proteins (e.g. S1P1 couples to Gi whereas S1P2 and S1P3 couple to Gq, G13 in addition to Gi) and regulate a extremely wide range of cellular events including cell motility, survival, apoptosis, migration and cellcell interaction. Important roles for S1P have also been reported in regulation of cardiogenesis, vascular maturation, oocyte survival, immune cell trafficking, cells of the neuronal system and bone cells. S1P levels are regulated by the activity of Sphk (Sphk1 and Sphk2).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NRA1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56034
Name Human PDGF-C (aa 183-265) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110064L01Rik; AI647969; C76851; fallotein; MGC102297; Pdgfc; PDGF-C; PDGFC latent form; PDGFC receptor-binding form; platelet derived growth factor C; platelet-derived growth factor C; Platelet-derived growth factor C, latent form; Platelet-derived growth factor C, receptor-binding form; platelet-derived growth factor, C polypeptide; rScdfg; Scdgf; secretory growth factor-like protein; spinal cord-derived growth factor; UNQ174/PRO200; VEGF-E
Common Name PDGF-C
Gene Symbol PDGFC
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.