missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200432

Invitrogen™ Human PAN3 (aa 739-865) Control Fragment Recombinant Protein

Product Code. 30200432
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200432

Brand: Invitrogen™ RP90645

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55984 (PA5-55984. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PAN3 is functions in cytoplasmic mRNA decay. It is as part of the Pan nuclease complex, recruits polyadenylate-binding protein which in turn stimulates PAN2 nuclease activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q58A45
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 255967
Name Human PAN3 (aa 739-865) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2700050F09Rik; A430027N15Rik; AU014670; PAB1P-dependent poly(A)-nuclease; PAB1P-dependent poly(A)-specific ribonuclease; PAB-dependent poly(A)-specific ribonuclease subunit 3; PAB-dependent poly(A)-specific ribonuclease subunit PAN3; Pabp1-dependent poly A-specific ribonuclease subunit Pan3; PABP-dependent poly(A) nuclease 3; PAN deadenylation complex subunit 3; PAN2-PAN3 deadenylation complex subunit Pan3; PAN3; PAN3 poly(A) specific ribonuclease subunit; PAN3 poly(A) specific ribonuclease subunit homolog; PAN3 polyA specific ribonuclease subunit homolog (S. cerevisiae); Poly(A)-nuclease deadenylation complex subunit 3; RP11-179F17.3
Common Name PAN3
Gene Symbol PAN3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.