missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210838

Invitrogen™ Human PAK4 (aa 37-92) Control Fragment Recombinant Protein

Product Code. 30210838
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210838

Brand: Invitrogen™ RP105495

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PAK4 is a serine/ threonine p21 activating kinase implicated in the reorganization of actin cytoskeleton and in the formation of filopodia. They are divided into two groups, the first of which include PAK1, 2 and 3, and can be activated by Cdc42/Rac binding. The second group includes PAK4, 5 and 6. These proteins are not activated by Cdc42/Rac binding. PAK4 was initially identified as a novel effector of Cdc42Hs. Co-expression of PAK4 and Cdc42Hs resulted in induction of filopodia and actin polymerization, showing that it is involved in cytoskeletal reorganization. Other experiments have shown PAK4 to be essential for embryonic viability and proper neuronal development. PAK4 has also been implicated in anchorage-independent growth of tumor cells and is required for activation of several cancer prosurvival pathways.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O96013
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10298
Name Human PAK4 (aa 37-92) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730488L07Rik; AW555722; hypothetical protein LOC431769; im:5916170; Kiaa1142; mKIAA1142; p21 (CDKN1A)-activated kinase 4; p21 (RAC1) activated kinase 4; p21 protein (Cdc42/Rac)-activated kinase 4; p21(CDKN1A)-activated kinase 4; p21-activated kinase 4; Pak4; PAK-4; protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs; serine/threonine-protein kinase PAK 4; wu:fd12b01; zgc:92014
Common Name PAK4
Gene Symbol Pak4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RQWQSLIEESARRPKPLVDPACITSIQPGAPKTIVRGSKGAKDGALTLLLDEFENM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.