missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209712

Invitrogen™ Human p130 (aa 636-764) Control Fragment Recombinant Protein

Product Code. 30209712
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209712

Brand: Invitrogen™ RP91613

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82690 (PA5-82690. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBL2 (also known as p130) or Retinoblastoma-like protein 2 is a key regulator of entry into cell division. It is directly involved in heterochromatin formation by maintaining overall chromatin structure and (in particular) that of constitutive heterochromatin by stabilizing histone methylation. RBL2 recruits and targets histone methyltransferases KMT5B and KMT5C leading to epigenetic transcriptional repression. It controls histone H4 'Lys20' trimethylation. It probably also acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. RBL2 serves as a potent inhibitor of E2F-mediated trans-activation and associates preferentially with E2F5.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q08999
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5934
Name Human p130 (aa 636-764) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 130 kDa retinoblastoma-associated protein; FLJ26459; p130; PPAR-alpha-interacting complex protein 128; PRB2; PRIC128; RB transcriptional corepressor like 2; Rb2; rb2 p130; Rbl2; RBR-2; retinoblastoma-like 2; retinoblastoma-like 2 (p130); retinoblastoma-like protein 2; Retinoblastoma-related protein 2
Common Name p130
Gene Symbol RBL2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IAGSPLTPRRVTEVRADTGGLGRSITSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPPQPLVNAVPVQNVSGETVSVTPVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.