missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206894

Invitrogen™ Human NQO1 (aa 138-273) Control Fragment Recombinant Protein

Product Code. 30206894
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30206894 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30206894 Supplier Invitrogen™ Supplier No. RP88713

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82294 (PA5-82294. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NQO1 is a member of the NAD(P)H dehydrogenase (quinone) family and a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. NQO1's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Altered expression of the protein has been seen in many tumors and is also associated with Alzheimer's disease (AD).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P15559
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1728
Name Human NQO1 (aa 138-273) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AV001255; Azoreductase; DHQU; DIA4; Diaphorase (NADH/NADPH); diaphorase (NADH/NADPH) (cytochrome b-5 reductase); Diaphorase 4; diaphorase 4 (NADH/NADPH); diaphorase-4; dioxin-inducible 1; DTD; DT-diaphorase; menadione reductase; NAD(P)H dehydrogenase (quinone); NAD(P)H dehydrogenase [quinone] 1; NAD(P)H dehydrogenase, quinone 1; NAD(P)H menadione oxidoreductase 1, dioxin inducible; NAD(P)H quinone dehydrogenase 1; NAD(P)H: quinone oxidoreductase 1; NAD(P)H:menadione oxidoreductase; NAD(P)H:menadione oxidoreductase 1; NAD(P)H:Quinone acceptor oxidoreductase type 1; NAD(P)H:quinone oxidoreductase 1; NAD(P)H:quinone oxireductase; NADPH-d; nicotinamide adenine dinucleotide phosphate diaphorase; Nmo1; Nmo-1; Nmor1; NMORI; NQ01; NQO1; O x 1; Ox-1; phylloquinone reductase; QR1; quinone reductase 1
Common Name NQO1
Gene Symbol NQO1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.